PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_098330_tssz.t2
Common NameSOVF_098330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family MIKC_MADS
Protein Properties Length: 250aa    MW: 28476.6 Da    PI: 8.0256
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_098330_tssz.t2genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.61.4e-27958150
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                       krie+ks rqvtfskRr g++KKA ELS+LCd++vav++fs++g+lye+ 
  Sp_098330_tssz.t2  9 KRIEDKSSRQVTFSKRRSGLIKKARELSILCDVDVAVLVFSHRGRLYEFV 58
                       79***********************************************7 PP

2K-box553.5e-191271953199
              K-box  31 LqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                         ++  R   G ++e+Lsl++ +qLe+qL+++l + R++K +l+le++ +l++kek+l +en +L+ +++
  Sp_098330_tssz.t2 127 VKTVERYAEGSGIENLSLEDFMQLEKQLNDALVQTRNRKAQLMLESVATLREKEKMLTQENDQLKDEVA 195
                        556678899*******************************************************99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.572161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.97E-27161IPR002100Transcription factor, MADS-box
SMARTSM004325.5E-37160IPR002100Transcription factor, MADS-box
CDDcd002651.65E-34257No hitNo description
PRINTSPR004041.1E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.8E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.63110200IPR002487Transcription factor, K-box
PfamPF014862.5E-15126194IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009910Biological Processnegative regulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MGRRKIEMKR IEDKSSRQVT FSKRRSGLIK KARELSILCD VDVAVLVFSH RGRLYEFVSG  60
ASSSSSATII YIFDFTRRTR RRKNCKCLSQ ILRRYQDSTD GKASNVDDET EDSPSTCIQV  120
QTCGELVKTV ERYAEGSGIE NLSLEDFMQL EKQLNDALVQ TRNRKAQLML ESVATLREKE  180
KMLTQENDQL KDEVAKVKGN LNRGNRTDLE LNGVMEEGAL IQCPEPVRTL PLLIEEGECP  240
EPVKTLPLLW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-16159159Myocyte-specific enhancer factor 2B
1tqe_R2e-16159159Myocyte-specific enhancer factor 2B
1tqe_Q2e-16159159Myocyte-specific enhancer factor 2B
1tqe_P2e-16159159Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010682732.11e-92PREDICTED: MADS-box transcription factor 23-like isoform X2
TrEMBLA0A0K9R9G50.0A0A0K9R9G5_SPIOL; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26310.12e-35MIKC_MADS family protein